PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM07G07280.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 276aa    MW: 30891.9 Da    PI: 6.4107
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM07G07280.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.61.7e-51171421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                      lppGfrFhPtdeelv +yL+++++g+  ++  +i+e+d+y+++PwdLp+++  +++ewyfF++rd+ky++g+r+nra++sgyWkatg dk+vl+
  OGLUM07G07280.1  17 LPPGFRFHPTDEELVAHYLCPRAAGRAAPV-PIIAELDLYRHDPWDLPHRALFGRREWYFFTPRDRKYPNGSRPNRAAASGYWKATGADKPVLH 109
                      79*************************999.88***************87778999************************************** PP

              NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       +g++ g+kk Lvfy+g+ p+g+kt+W+mheyrl
  OGLUM07G07280.1 110 -NGRTAGIKKALVFYHGKPPRGVKTEWIMHEYRL 142
                      .999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.89E-6313170IPR003441NAC domain
PROSITE profilePS5100558.91917170IPR003441NAC domain
PfamPF023653.2E-2718142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MAAAKRRVRD AEADLNLPPG FRFHPTDEEL VAHYLCPRAA GRAAPVPIIA ELDLYRHDPW  60
DLPHRALFGR REWYFFTPRD RKYPNGSRPN RAAASGYWKA TGADKPVLHN GRTAGIKKAL  120
VFYHGKPPRG VKTEWIMHEY RLAKKGGAAA AAGAGALRLD DWVLCRLYNK KNEWEKMQSR  180
KEEEEAMAAA QSWGETRTPE SEVVDSDAFQ EMDYSLPAAS FDDALLPKEE ARDDDWLMGM  240
SLDDLQGLGS LLQADDLSML APPPAAKTEP LGAPFF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-9561764174Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0281820.0AB028182.1 Oryza sativa mRNA for OsNAC3 protein, complete cds.
GenBankAK0736670.0AK073667.1 Oryza sativa Japonica Group cDNA clone:J033052E11, full insert sequence.
GenBankAP0045720.0AP004572.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, PAC clone:P0668C05.
GenBankAP0055160.0AP005516.5 Oryza sativa Japonica Group genomic DNA, chromosome 7, BAC clone:OSJNBa0066H10.
GenBankAP0149630.0AP014963.1 Oryza sativa Japonica Group DNA, chromosome 7, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015645028.10.0PREDICTED: NAC domain-containing protein 67
SwissprotQ7EZT10.0NAC67_ORYSJ; NAC domain-containing protein 67
TrEMBLA0A0E0AHE50.0A0A0E0AHE5_9ORYZ; Uncharacterized protein
STRINGLOC_Os07g12340.10.0(Oryza sativa Japonica Group)
STRINGORGLA07G0064400.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44143071
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.13e-78NAC domain containing protein 32